PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000338280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 363aa    MW: 40486 Da    PI: 7.7244
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000338280genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.88.2e-20284317134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    C++C++tkTp+WR+gp g+ktLCnaCG++yr+ +
  MDP0000338280 284 CTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGR 317
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.9E-16278328IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.571278314IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.51E-15281341No hitNo description
Gene3DG3DSA:3.30.50.102.0E-14282315IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.49E-16283330No hitNo description
PROSITE patternPS003440284309IPR000679Zinc finger, GATA-type
PfamPF003201.4E-17284317IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
HLLLLLSSFF FSSATLSLSP LSSLLSSNID SHQLSLSLSV EVLTGTMTAV SADVTKLTKR  60
ERPNRVLREL GIRACAVNIS DMDGSLPTDG AFNYESFLGN DILSALDFPM EDIDDSVEDN  120
DWDXKFQDIE PPPNIDQLLG PGIFSYDDKK KHTNLSTPYE QMYQPQFPSV TCETIRSKGS  180
LRNDDHESIG SCAAQFEPKF EKRTRSKLSR SRRANPVTFS TQFIPSTSSN SSATENLYHW  240
DACKFDIESS RTEDMLNTTK RKQKKKTGKL TTDEPGESRE AKRCTHCQVT KTPQWREGPL  300
GPKTLCNACG VRYRSGRLFP EYRPAASPTF VAAVHSNSHK KVIELRSKGC QEAVMGILSS  360
ARX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.7451e-152bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359133.10.0PREDICTED: GATA transcription factor 11-like isoform X1
TrEMBLM5VZX12e-90M5VZX1_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57582849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-37GATA family protein